PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_027755
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family HD-ZIP
Protein Properties Length: 313aa    MW: 35293.9 Da    PI: 8.5944
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_027755genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.3e-19146200256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ ++tkeq  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  DCAR_027755 146 RKKLRLTKEQSAILEESFKEHNTLNPKQKIALAKRLGLRPRQVEVWFQNRRARTK 200
                  78889************************************************98 PP

2HD-ZIP_I/II128.23.5e-41146236192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rl+keq+++LEesF+e+++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een++L+kev+eLr +lk
  DCAR_027755 146 RKKLRLTKEQSAILEESFKEHNTLNPKQKIALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCQSLTEENRKLQKEVQELR-ALK 236
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.2E-254117IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.609.5E-19135196IPR009057Homeodomain-like
SuperFamilySSF466892.67E-19136203IPR009057Homeodomain-like
PROSITE profilePS5007117.621142202IPR001356Homeobox domain
SMARTSM003896.9E-17144206IPR001356Homeobox domain
PfamPF000461.3E-16146200IPR001356Homeobox domain
CDDcd000869.70E-16146203No hitNo description
PRINTSPR000313.4E-5173182IPR000047Helix-turn-helix motif
PROSITE patternPS000270177200IPR017970Homeobox, conserved site
PRINTSPR000313.4E-5182198IPR000047Helix-turn-helix motif
PfamPF021834.3E-11202236IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.4E-26202245IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MMVQQRDDLG LSLSLSLPGP SQNTNKISDH NQMAYATKPL ELNLMPSQPL NLLPNTTTWT  60
HPASYDRKME ACRVDRRSFL TGIDVNRAPA ATVEMEEENG MSSPNSTISS LSGNKRSLVN  120
EKSELANGDE LLEFSRSDDE DGDNSRKKLR LTKEQSAILE ESFKEHNTLN PKQKIALAKR  180
LGLRPRQVEV WFQNRRARTK LKQTEVDCEF LKRCCQSLTE ENRKLQKEVQ ELRALKSSPQ  240
FYMQMTPPTT LTMCPSCERV GGPQSATTSS LAPSVTTAEP LRSYPMSTNH HRLPFNPWAS  300
SHRPLDDVHP RT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144150SRKKLRL
2194202RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX951930.0X95193.1 P.brachycarpa mRNA for homeobox-leucine zipper protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589459.11e-116PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466001e-84HAT1_ARATH; Homeobox-leucine zipper protein HAT1
TrEMBLQ407810.0Q40781_PIMBR; Homeobox-leucine zipper protein
STRINGVIT_00s0299g00100.t011e-112(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17460.17e-84Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein